Amino terminal enhancer of split (AES) Rabbit Polyclonal Antibody TA330249 from OriGene Technologies | Biocompare.com

Supplier Images

Amino terminal enhancer of split (AES) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Amino terminal enhancer of split (AES) Rabbit Polyclonal Antibody

OriGene Technologies' Amino terminal enhancer of split (AES) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Amino terminal enhancer of split (AES) Rabbit Polyclonal Antibody was generated using TLE family member 5, transcriptional modulator, and TLE5 as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-AES Antibody

Product Specs
ItemAmino terminal enhancer of split (AES) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA330249
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetTLE5
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-AES antibody: synthetic peptide directed towards the middle region of human AES. Synthetic peptide located within the following region: HKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQ
NCBI Full Gene NameTLE family member 5, transcriptional modulator
NCBI Gene AliasesGrg-5, AES, GRG5, GRG, ESP1, AES-2, AES-1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!